PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA32952
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family G2-like
Protein Properties Length: 149aa    MW: 17138 Da    PI: 10.517
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA32952genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like55.71.1e-172673451
                    G2-like  4 lrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51
                               +rWt+eLHe+F+  v++ G +ekA Pk+il++mk + ++l+h kSHLQ
  Tp57577_TGAC_v2_mRNA32952 26 IRWTEELHESFMMIVDHVGCPEKAKPKAILDMMKSNLISLSHGKSHLQ 73
                               79********************************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466897.17E-82274IPR009057Homeodomain-like
TIGRFAMsTIGR015572.1E-142374IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.4E-142573IPR009057Homeodomain-like
Gene3DG3DSA:3.60.40.103.1E-485141IPR001932PPM-type phosphatase domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0003824Molecular Functioncatalytic activity
Sequence ? help Back to Top
Protein Sequence    Length: 149 aa     Download sequence    Send to blast
MYIQAHIQRV TSNNAFRKAL TCKRWIRWTE ELHESFMMIV DHVGCPEKAK PKAILDMMKS  60
NLISLSHGKS HLQVKLFKFN LNNFNEPEVY SRLLKDTDRF IIWKLISNED AAKVVNSNTS  120
PRDRIAKRLA TLALEKGADK RGKDIVTL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF144901016
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04450.26e-12G2-like family protein